![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.5: Zf-UBP [161204] (4 proteins) Pfam PF02148 |
![]() | Protein Hypothetical protein RPA1320 [161205] (1 species) |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [161206] (1 PDB entry) Uniprot Q6NA67 1-102 |
![]() | Domain d2idaa1: 2ida A:1-102 [147626] complexed with zn |
PDB Entry: 2ida (more details)
SCOPe Domain Sequences for d2idaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]} mtmgcrhvagirtvtpsalgceeclkigspwvhlricrtcghvgccddsphkhatrhfha tghpiiegydppegwgwcyvdevmfdlsdrmtphngpipryv
Timeline for d2idaa1: