Lineage for d2idaa1 (2ida A:1-102)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037640Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 3037641Protein Hypothetical protein RPA1320 [161205] (1 species)
  7. 3037642Species Rhodopseudomonas palustris [TaxId:1076] [161206] (1 PDB entry)
    Uniprot Q6NA67 1-102
  8. 3037643Domain d2idaa1: 2ida A:1-102 [147626]
    complexed with zn

Details for d2idaa1

PDB Entry: 2ida (more details)

PDB Description: solution nmr structure of protein rpa1320 from rhodopseudomonas palustris. northeast structural genomics consortium target rpt3; ontario center for structural proteomics target rp1313.
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2idaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idaa1 g.44.1.5 (A:1-102) Hypothetical protein RPA1320 {Rhodopseudomonas palustris [TaxId: 1076]}
mtmgcrhvagirtvtpsalgceeclkigspwvhlricrtcghvgccddsphkhatrhfha
tghpiiegydppegwgwcyvdevmfdlsdrmtphngpipryv

SCOPe Domain Coordinates for d2idaa1:

Click to download the PDB-style file with coordinates for d2idaa1.
(The format of our PDB-style files is described here.)

Timeline for d2idaa1: