SCOPe 2.02: Domain d2id6a1: 2id6 A:1-75

Lineage for d2id6a1 (2id6 A:1-75)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Transcriptional regulator TM1030 [140209] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries)
   Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75

8. Domain d2id6a1: 2id6 A:1-75 [147624]
   Other proteins in same PDB: d2id6a2
   automatically matched to d1z77a1
   complexed with edo

Details for d2id6a1

PDB Entry: 2id6, 1.75 Å

PDB Description: crystal structure of transcriptional regulator (tm1030) at 1.75a resolution

PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2id6a1:

Sequence; same for both SEQRES and ATOM records:

>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
klqkefenflmknrn

Timeline for d2id6a1:

• d2id6a1 first appeared in SCOP 1.75
  
• d2id6a1 appears in SCOPe 2.01
  
• d2id6a1 appears in SCOPe 2.03
  
• d2id6a1 appears in the current release, SCOPe 2.08