Lineage for d2id6a1 (2id6 A:1-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761504Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)
  6. 761724Protein Transcriptional regulator TM1030 [140209] (1 species)
  7. 761725Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries)
    Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75
  8. 761726Domain d2id6a1: 2id6 A:1-75 [147624]
    Other proteins in same PDB: d2id6a2
    automatically matched to d1z77a1
    complexed with edo

Details for d2id6a1

PDB Entry: 2id6 (more details), 1.75 Å

PDB Description: crystal structure of transcriptional regulator (tm1030) at 1.75a resolution
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOP Domain Sequences for d2id6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
klqkefenflmknrn

SCOP Domain Coordinates for d2id6a1:

Click to download the PDB-style file with coordinates for d2id6a1.
(The format of our PDB-style files is described here.)

Timeline for d2id6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2id6a2