Lineage for d2id0d1 (2id0 D:558-644)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399359Protein Exoribonuclease 2, RNB [159089] (1 species)
    RNase II; contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain
  7. 2399360Species Escherichia coli [TaxId:562] [159090] (3 PDB entries)
    Uniprot P30850 1-82! Uniprot P30850 4-82! Uniprot P30850 5-82! Uniprot P30850 558-643! Uniprot P30850 558-644! Uniprot P30850 83-172
  8. 2399376Domain d2id0d1: 2id0 D:558-644 [147618]
    Other proteins in same PDB: d2id0a4, d2id0b4, d2id0c4, d2id0d4
    automated match to d2id0a1
    complexed with mn

Details for d2id0d1

PDB Entry: 2id0 (more details), 2.35 Å

PDB Description: escherichia coli rnase ii
PDB Compounds: (D:) Exoribonuclease 2

SCOPe Domain Sequences for d2id0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id0d1 b.40.4.5 (D:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
agtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqengtvqikgetv
ykvtdvidvtiaevrmetrsiiarpva

SCOPe Domain Coordinates for d2id0d1:

Click to download the PDB-style file with coordinates for d2id0d1.
(The format of our PDB-style files is described here.)

Timeline for d2id0d1: