Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Exoribonuclease 2, RNB, middle domain [418921] (1 species) RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
Species Escherichia coli [TaxId:562] [419349] (3 PDB entries) Uniprot P30850 |
Domain d2id0c2: 2id0 C:83-172 [147615] Other proteins in same PDB: d2id0a1, d2id0a3, d2id0a4, d2id0b1, d2id0b3, d2id0b4, d2id0c1, d2id0c3, d2id0c4, d2id0d1, d2id0d3, d2id0d4 automated match to d2id0a2 complexed with mn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2id0 (more details), 2.35 Å
SCOPe Domain Sequences for d2id0c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id0c2 b.40.4.5 (C:83-172) Exoribonuclease 2, RNB, middle domain {Escherichia coli [TaxId: 562]} ltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefkegdwavaemrrhplkgdrs fyaeltqyitfgddhfvpwwvtlarhnlek
Timeline for d2id0c2: