![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Exoribonuclease 2, RNB [159089] (1 species) RNase II; contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
![]() | Species Escherichia coli [TaxId:562] [159090] (3 PDB entries) Uniprot P30850 1-82! Uniprot P30850 4-82! Uniprot P30850 5-82! Uniprot P30850 558-643! Uniprot P30850 558-644! Uniprot P30850 83-172 |
![]() | Domain d2id0c1: 2id0 C:558-644 [147614] Other proteins in same PDB: d2id0a4, d2id0b4, d2id0c4, d2id0d4 automated match to d2id0a1 complexed with mn |
PDB Entry: 2id0 (more details), 2.35 Å
SCOPe Domain Sequences for d2id0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2id0c1 b.40.4.5 (C:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} agtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqengtvqikgetv ykvtdvidvtiaevrmetrsiiarpva
Timeline for d2id0c1: