Lineage for d2id0a4 (2id0 A:173-557)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052173Family b.40.4.16: RNB domain-like [159112] (3 protein domains)
    Pfam PF00773; RNase II catalytic domain; decorated OB-fold domain with extra C-terminal structures forming the active site
  6. 2052174Protein Exoribonuclease 2, RNB [159117] (1 species)
    RNase II
  7. 2052175Species Escherichia coli [TaxId:562] [159118] (3 PDB entries)
    Uniprot P30850 173-557
  8. 2052177Domain d2id0a4: 2id0 A:173-557 [147609]
    Other proteins in same PDB: d2id0a1, d2id0a2, d2id0a3, d2id0b1, d2id0b2, d2id0b3, d2id0c1, d2id0c2, d2id0c3, d2id0d1, d2id0d2, d2id0d3
    complexed with mn

Details for d2id0a4

PDB Entry: 2id0 (more details), 2.35 Å

PDB Description: escherichia coli rnase ii
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2id0a4:

Sequence, based on SEQRES records: (download)

>d2id0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
eapdgvatemldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadpt
awiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadg
tiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrh
nhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgi
ynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfq
sfaeistepgphfglgleayatwtspirkygdminhrllkavikgetatrpqdeitvqma
errrlnrmaerdvgdwlyarflkdk

Sequence, based on observed residues (ATOM records): (download)

>d2id0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
eapdgvatemldeglvredltaldfvtidsastedmddalfakalpddklqlivaiadpt
awiaegskldkaakiraftnylpgfnipmlprelsddlcslranevrpvlacrmtlsadg
tiednieffaatieskaklvydqvsdwlentgdwqpeseaiaeqvrllaqicqrrgewrh
nhalvfkdrpdyrfilgekgevldivaeprrianriveeamiaanicaarvlrdklgfgi
ynvhmgfdpanadalaallkthglhvdaeevltldgfcklrreldaqptgfldsrirrfq
sfaeistepgphfglgleayatwtspirkygdminhrllkavikgrpqdeitvqmaerrr
lnrmaerdvgdwlyarflkdk

SCOPe Domain Coordinates for d2id0a4:

Click to download the PDB-style file with coordinates for d2id0a4.
(The format of our PDB-style files is described here.)

Timeline for d2id0a4: