Lineage for d2id0a3 (2id0 A:5-82)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789131Protein Exoribonuclease 2, RNB [159089] (1 species)
    RNase II; contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain
  7. 1789132Species Escherichia coli [TaxId:562] [159090] (3 PDB entries)
    Uniprot P30850 1-82! Uniprot P30850 4-82! Uniprot P30850 5-82! Uniprot P30850 558-643! Uniprot P30850 558-644! Uniprot P30850 83-172
  8. 1789138Domain d2id0a3: 2id0 A:5-82 [147608]
    Other proteins in same PDB: d2id0a4, d2id0b4, d2id0c4, d2id0d4
    complexed with mn

Details for d2id0a3

PDB Entry: 2id0 (more details), 2.35 Å

PDB Description: escherichia coli rnase ii
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2id0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id0a3 b.40.4.5 (A:5-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]}
npllaqlkqqlhsqtpraegvvkatekgfgflevdaqksyfipppqmkkvmhgdriiavi
hsekeresaepeelvepf

SCOPe Domain Coordinates for d2id0a3:

Click to download the PDB-style file with coordinates for d2id0a3.
(The format of our PDB-style files is described here.)

Timeline for d2id0a3: