Lineage for d2id0a1 (2id0 A:558-644)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. Protein Exoribonuclease 2, RNB, C-terminal domain [418922] (1 species)
    RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain
  7. Species Escherichia coli [TaxId:562] [419350] (3 PDB entries)
    Uniprot P30850
  8. Domain d2id0a1: 2id0 A:558-644 [147606]
    Other proteins in same PDB: d2id0a2, d2id0a3, d2id0a4, d2id0b2, d2id0b3, d2id0b4, d2id0c2, d2id0c3, d2id0c4, d2id0d2, d2id0d3, d2id0d4
    complexed with mn

Details for d2id0a1

PDB Entry: 2id0 (more details), 2.3499999999999996 Å

PDB Description: escherichia coli rnase ii
PDB Compounds: (A:) Exoribonuclease 2

SCOPe Domain Sequences for d2id0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id0a1 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB, C-terminal domain {Escherichia coli [TaxId: 562]}
agtdtrfaaeivdisrggmrvrlvdngaiafipapflhavrdelvcsqengtvqikgetv
ykvtdvidvtiaevrmetrsiiarpva

SCOPe Domain Coordinates for d2id0a1 are not available.

Timeline for d2id0a1:

Domains from same chain:
(mouse over for more information)
d2id0a2, d2id0a3, d2id0a4
Domains from other chains:
(mouse over for more information)
d2id0b1, d2id0b2, d2id0b3, d2id0b4, d2id0c1, d2id0c2, d2id0c3, d2id0c4, d2id0d1, d2id0d2, d2id0d3, d2id0d4