Lineage for d2ichb_ (2ich B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078424Fold b.176: AttH-like [159244] (1 superfamily)
    duplication: two flattened beta-barrels of lipocalin-like topology are orthogonally packed with a pseudo twofold symmetry
  4. 2078425Superfamily b.176.1: AttH-like [159245] (1 family) (S)
    automatically mapped to Pfam PF07143
  5. 2078426Family b.176.1.1: AttH-like [159246] (1 protein)
    Pfam PF09410; DUF2006
  6. 2078427Protein AttH-related protein NE1406 [159247] (1 species)
  7. 2078428Species Nitrosomonas europaea [TaxId:915] [159248] (1 PDB entry)
    Uniprot Q82US3 24-351
  8. 2078430Domain d2ichb_: 2ich B: [147603]
    automated match to d2icha1
    complexed with gol, nhe, so4

Details for d2ichb_

PDB Entry: 2ich (more details), 2 Å

PDB Description: crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution
PDB Compounds: (B:) Putative AttH

SCOPe Domain Sequences for d2ichb_:

Sequence, based on SEQRES records: (download)

>d2ichb_ b.176.1.1 (B:) AttH-related protein NE1406 {Nitrosomonas europaea [TaxId: 915]}
lapvvpgkalefpqdfgahndfriewwyvtgwletptgkplgfqitffrtateidrdnps
hfapdqliiahvalsdpaigklqhdqkiaragfdlayartgntdvklddwifvretdgry
rtrieaedftltfiltpsqplmlqgengfsrkgpgapqasyyysephlqvsgiinrqged
ipvtgtawldrewsseyldpnaagwdwisanlddgsalmafqirgkddskiwayaalrda
sghtrlftpdqvsfhpirtwrsartqavypvatrvltgetewqitplmddqeldsrasag
avywegavtftrdgqpagrgymeltgyvr

Sequence, based on observed residues (ATOM records): (download)

>d2ichb_ b.176.1.1 (B:) AttH-related protein NE1406 {Nitrosomonas europaea [TaxId: 915]}
lapvvpgkalefpqdfgahndfriewwyvtgwletptgkplgfqitffrtanpshfapdq
liiahvalsdpaigklqhdqkiaragfdlayartgntdvklddwifvretdgryrtriea
edftltfiltpsqplmlqgengfsrkgpgapqasyyysephlqvsgiinrqgedipvtgt
awldrewsseyldpnaagwdwisanlddgsalmafqirgkddskiwayaalrdasghtrl
ftpdqvsfhpirtwrsartqavypvatrvltgetewqitplmddqeldsrasagavyweg
avtftrdgqpagrgymeltgyvr

SCOPe Domain Coordinates for d2ichb_:

Click to download the PDB-style file with coordinates for d2ichb_.
(The format of our PDB-style files is described here.)

Timeline for d2ichb_: