Lineage for d2icga1 (2icg A:1-158)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617455Fold d.369: SMI1/KNR4-like [160630] (1 superfamily)
    alpha(4)-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet, order 1234(meander)
  4. 2617456Superfamily d.369.1: SMI1/KNR4-like [160631] (1 family) (S)
  5. 2617457Family d.369.1.1: SMI1/KNR4-like [160632] (3 proteins)
    Pfam PF09346
  6. 2617461Protein Uncharacterized protein Lin2918 [160633] (1 species)
  7. 2617462Species Listeria innocua [TaxId:1642] [160634] (1 PDB entry)
    Uniprot Q926X2 1-158
  8. 2617463Domain d2icga1: 2icg A:1-158 [147601]
    Other proteins in same PDB: d2icga2
    complexed with cl, so4

Details for d2icga1

PDB Entry: 2icg (more details), 1.65 Å

PDB Description: crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution
PDB Compounds: (A:) Lin2918 protein

SCOPe Domain Sequences for d2icga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icga1 d.369.1.1 (A:1-158) Uncharacterized protein Lin2918 {Listeria innocua [TaxId: 1642]}
massfleevdrlitlsgitfhasgtgtpelikiyqdalgnefpetyklflekygtltfng
vsfygiskrglsaasipdvkfateqartfgdinkemimiknsgygsifsidtsiigsege
pvivetnlsfkdntekkvvansfgeflleeielsltdl

SCOPe Domain Coordinates for d2icga1:

Click to download the PDB-style file with coordinates for d2icga1.
(The format of our PDB-style files is described here.)

Timeline for d2icga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2icga2