Lineage for d2icga1 (2icg A:1-158)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1054050Fold d.369: SMI1/KNR4-like [160630] (1 superfamily)
    alpha(4)-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet, order 1234(meander)
  4. 1054051Superfamily d.369.1: SMI1/KNR4-like [160631] (1 family) (S)
  5. 1054052Family d.369.1.1: SMI1/KNR4-like [160632] (3 proteins)
    Pfam PF09346
  6. 1054056Protein Uncharacterized protein Lin2918 [160633] (1 species)
  7. 1054057Species Listeria innocua [TaxId:1642] [160634] (1 PDB entry)
    Uniprot Q926X2 1-158
  8. 1054058Domain d2icga1: 2icg A:1-158 [147601]
    complexed with cl, so4

Details for d2icga1

PDB Entry: 2icg (more details), 1.65 Å

PDB Description: crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution
PDB Compounds: (A:) Lin2918 protein

SCOPe Domain Sequences for d2icga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2icga1 d.369.1.1 (A:1-158) Uncharacterized protein Lin2918 {Listeria innocua [TaxId: 1642]}
massfleevdrlitlsgitfhasgtgtpelikiyqdalgnefpetyklflekygtltfng
vsfygiskrglsaasipdvkfateqartfgdinkemimiknsgygsifsidtsiigsege
pvivetnlsfkdntekkvvansfgeflleeielsltdl

SCOPe Domain Coordinates for d2icga1:

Click to download the PDB-style file with coordinates for d2icga1.
(The format of our PDB-style files is described here.)

Timeline for d2icga1: