SCOPe 2.08: Domain d2ibka1: 2ibk A:241-341

Lineage for d2ibka1 (2ibk A:241-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d2ibka1: 2ibk A:241-341 [147598]
   Other proteins in same PDB: d2ibka2
   automated match to d1jx4a1
   protein/DNA complex; complexed with bap, ca, edo, gol, pop

Details for d2ibka1

PDB Entry: 2ibk, 2.25 Å

PDB Description: Bypass of Major Benzopyrene-dG Adduct by Y-Family DNA Polymerase with Unique Structural Gap

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2ibka1:

Sequence; same for both SEQRES and ATOM records:

>d2ibka1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2ibka1:

• d2ibka1 first appeared in SCOP 1.75
  
• d2ibka1 appears in SCOPe 2.07