![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.376: Lp2179-like [160799] (1 superfamily) beta(2)-alpha-beta(4)-alpha-beta; contains two antiparallel beta-sheets (orders: 127 and 3456) packed against the longer C-terminal helix |
![]() | Superfamily d.376.1: Lp2179-like [160800] (1 family) ![]() automatically mapped to Pfam PF08866 |
![]() | Family d.376.1.1: Lp2179-like [160801] (1 protein) Pfam PF08866, DUF1831 |
![]() | Protein Hypothetical protein Lp2179 [160802] (1 species) |
![]() | Species Lactobacillus plantarum [TaxId:1590] [160803] (1 PDB entry) Uniprot Q88V95 1-113 |
![]() | Domain d2iaya1: 2iay A:1-113 [147592] Other proteins in same PDB: d2iaya2 complexed with cl, gol |
PDB Entry: 2iay (more details), 1.2 Å
SCOPe Domain Sequences for d2iaya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iaya1 d.376.1.1 (A:1-113) Hypothetical protein Lp2179 {Lactobacillus plantarum [TaxId: 1590]} maytttvkldgdtktytlsptvkkytlmdlgfvkgrsgafsfersldptspyqaafklkm tvnadltgfkmttvtgngvqranifkndahpeaveqlryilanfierdilttd
Timeline for d2iaya1: