SCOPe 2.07: Domain d2ia9e2: 2ia9 E:1-87

Lineage for d2ia9e2 (2ia9 E:1-87)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.366: SpoVG-like [160536] (1 superfamily)
   beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin

4. Superfamily d.366.1: SpoVG-like [160537] (1 family)
   probable biological unit is a hexamer (trimer of dimers)
   automatically mapped to Pfam PF04026

5. Family d.366.1.1: SpoVG-like [160538] (1 protein)
   Pfam PF04026

6. Protein Putative septation protein SpoVG [160539] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry)
   Uniprot P28015 1-92

8. Domain d2ia9e2: 2ia9 E:1-87 [147590]
   Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3
   automated match to d2ia9a1
   complexed with peg, so4

Details for d2ia9e2

PDB Entry: 2ia9, 3 Å

PDB Description: Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (E:) Putative septation protein spoVG

SCOPe Domain Sequences for d2ia9e2:

Sequence, based on SEQRES records:

>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi
thpinsstrgkiqdavlneyhrlgdte

Sequence, based on observed residues (ATOM records):

>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskefrdithpin
sstrgkiqdavlneyhrlgdte

Timeline for d2ia9e2:

• d2ia9e2 first appeared in SCOP 1.75, called d2ia9e1
  
• d2ia9e2 appears in SCOPe 2.06
  
• d2ia9e2 appears in the current release, SCOPe 2.08