![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.366: SpoVG-like [160536] (1 superfamily) beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin |
![]() | Superfamily d.366.1: SpoVG-like [160537] (1 family) ![]() probable biological unit is a hexamer (trimer of dimers) automatically mapped to Pfam PF04026 |
![]() | Family d.366.1.1: SpoVG-like [160538] (1 protein) Pfam PF04026 |
![]() | Protein Putative septation protein SpoVG [160539] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry) Uniprot P28015 1-92 |
![]() | Domain d2ia9e2: 2ia9 E:1-87 [147590] Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3 automated match to d2ia9a1 complexed with peg, so4 |
PDB Entry: 2ia9 (more details), 3 Å
SCOPe Domain Sequences for d2ia9e2:
Sequence, based on SEQRES records: (download)
>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]} mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi thpinsstrgkiqdavlneyhrlgdte
>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]} mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskefrdithpin sstrgkiqdavlneyhrlgdte
Timeline for d2ia9e2: