Lineage for d2ia9e2 (2ia9 E:1-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011622Fold d.366: SpoVG-like [160536] (1 superfamily)
    beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin
  4. 3011623Superfamily d.366.1: SpoVG-like [160537] (1 family) (S)
    probable biological unit is a hexamer (trimer of dimers)
    automatically mapped to Pfam PF04026
  5. 3011624Family d.366.1.1: SpoVG-like [160538] (1 protein)
    Pfam PF04026
  6. 3011625Protein Putative septation protein SpoVG [160539] (2 species)
  7. 3011626Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry)
    Uniprot P28015 1-92
  8. 3011631Domain d2ia9e2: 2ia9 E:1-87 [147590]
    Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3
    automated match to d2ia9a1
    complexed with peg, so4

Details for d2ia9e2

PDB Entry: 2ia9 (more details), 3 Å

PDB Description: Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (E:) Putative septation protein spoVG

SCOPe Domain Sequences for d2ia9e2:

Sequence, based on SEQRES records: (download)

>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi
thpinsstrgkiqdavlneyhrlgdte

Sequence, based on observed residues (ATOM records): (download)

>d2ia9e2 d.366.1.1 (E:1-87) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskefrdithpin
sstrgkiqdavlneyhrlgdte

SCOPe Domain Coordinates for d2ia9e2:

Click to download the PDB-style file with coordinates for d2ia9e2.
(The format of our PDB-style files is described here.)

Timeline for d2ia9e2: