Lineage for d2ia9c2 (2ia9 C:1-86)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617396Fold d.366: SpoVG-like [160536] (1 superfamily)
    beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin
  4. 2617397Superfamily d.366.1: SpoVG-like [160537] (1 family) (S)
    probable biological unit is a hexamer (trimer of dimers)
    automatically mapped to Pfam PF04026
  5. 2617398Family d.366.1.1: SpoVG-like [160538] (1 protein)
    Pfam PF04026
  6. 2617399Protein Putative septation protein SpoVG [160539] (2 species)
  7. 2617400Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry)
    Uniprot P28015 1-92
  8. 2617403Domain d2ia9c2: 2ia9 C:1-86 [147588]
    Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3
    automated match to d2ia9a1
    complexed with peg, so4

Details for d2ia9c2

PDB Entry: 2ia9 (more details), 3 Å

PDB Description: Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (C:) Putative septation protein spoVG

SCOPe Domain Sequences for d2ia9c2:

Sequence, based on SEQRES records: (download)

>d2ia9c2 d.366.1.1 (C:1-86) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi
thpinsstrgkiqdavlneyhrlgdt

Sequence, based on observed residues (ATOM records): (download)

>d2ia9c2 d.366.1.1 (C:1-86) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrdgefrdith
pinsstrgkiqdavlneyhrlgdt

SCOPe Domain Coordinates for d2ia9c2:

Click to download the PDB-style file with coordinates for d2ia9c2.
(The format of our PDB-style files is described here.)

Timeline for d2ia9c2: