SCOPe 2.08: Domain d2ia9b2: 2ia9 B:1-93

Lineage for d2ia9b2 (2ia9 B:1-93)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.366: SpoVG-like [160536] (1 superfamily)
   beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin

4. Superfamily d.366.1: SpoVG-like [160537] (1 family)
   probable biological unit is a hexamer (trimer of dimers)
   automatically mapped to Pfam PF04026

5. Family d.366.1.1: SpoVG-like [160538] (1 protein)
   Pfam PF04026

6. Protein Putative septation protein SpoVG [160539] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry)
   Uniprot P28015 1-92

8. Domain d2ia9b2: 2ia9 B:1-93 [147587]
   Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3
   automated match to d2ia9a1
   complexed with peg, so4

Details for d2ia9b2

PDB Entry: 2ia9, 3 Å

PDB Description: Structural Genomics, the crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (B:) Putative septation protein spoVG

SCOPe Domain Sequences for d2ia9b2:

Sequence; same for both SEQRES and ATOM records:

>d2ia9b2 d.366.1.1 (B:1-93) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]}
mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi
thpinsstrgkiqdavlneyhrlgdtealefee

Timeline for d2ia9b2:

• d2ia9b2 first appeared in SCOP 1.75, called d2ia9b1
  
• d2ia9b2 appears in SCOPe 2.07