Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.366: SpoVG-like [160536] (1 superfamily) beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin |
Superfamily d.366.1: SpoVG-like [160537] (1 family) probable biological unit is a hexamer (trimer of dimers) automatically mapped to Pfam PF04026 |
Family d.366.1.1: SpoVG-like [160538] (1 protein) Pfam PF04026 |
Protein Putative septation protein SpoVG [160539] (2 species) |
Species Bacillus subtilis [TaxId:1423] [160540] (1 PDB entry) Uniprot P28015 1-92 |
Domain d2ia9a1: 2ia9 A:1-92 [147586] Other proteins in same PDB: d2ia9a2, d2ia9b3, d2ia9c3, d2ia9d3, d2ia9e3, d2ia9f3 complexed with peg, so4 |
PDB Entry: 2ia9 (more details), 3 Å
SCOPe Domain Sequences for d2ia9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ia9a1 d.366.1.1 (A:1-92) Putative septation protein SpoVG {Bacillus subtilis [TaxId: 1423]} mevtdvrlrrvntdgrmraiasitldhefvvhdirvidgnnglfvampskrtpdgefrdi thpinsstrgkiqdavlneyhrlgdtealefe
Timeline for d2ia9a1: