Lineage for d2ia7a1 (2ia7 A:23-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011727Fold d.373: gpW/gp25-like [160718] (1 superfamily)
    alpha(2)-beta(3); similar to one structural repeat of the Creatinase/aminopeptidase family and the C-terminal subdomain of PanC
  4. 3011728Superfamily d.373.1: gpW/gp25-like [160719] (1 family) (S)
    Contains phage tail lysozyme
    automatically mapped to Pfam PF04965
  5. 3011729Family d.373.1.1: gpW/gp25-like [160720] (1 protein)
    Pfam PF04965; T4 gene 25-like lysozyme
  6. 3011730Protein Uncharacterized protein GSU0986 [160721] (1 species)
  7. 3011731Species Geobacter sulfurreducens [TaxId:35554] [160722] (1 PDB entry)
    Uniprot Q74EH6 23-133
  8. 3011732Domain d2ia7a1: 2ia7 A:23-133 [147585]
    complexed with edo, no3

Details for d2ia7a1

PDB Entry: 2ia7 (more details), 1.44 Å

PDB Description: crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution
PDB Compounds: (A:) Tail lysozyme, putative

SCOPe Domain Sequences for d2ia7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ia7a1 d.373.1.1 (A:23-133) Uncharacterized protein GSU0986 {Geobacter sulfurreducens [TaxId: 35554]}
amvlssaeediaesiriilgtargervmrpdfgcgihdrvfsvintttlglienevkeal
ilwepriellsvtaspreaaegrllidieyrvrstntrfnlvypfylkesa

SCOPe Domain Coordinates for d2ia7a1:

Click to download the PDB-style file with coordinates for d2ia7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ia7a1: