Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.373: gpW/gp25-like [160718] (1 superfamily) alpha(2)-beta(3); similar to one structural repeat of the Creatinase/aminopeptidase family and the C-terminal subdomain of PanC |
Superfamily d.373.1: gpW/gp25-like [160719] (1 family) Contains phage tail lysozyme automatically mapped to Pfam PF04965 |
Family d.373.1.1: gpW/gp25-like [160720] (1 protein) Pfam PF04965; T4 gene 25-like lysozyme |
Protein Uncharacterized protein GSU0986 [160721] (1 species) |
Species Geobacter sulfurreducens [TaxId:35554] [160722] (1 PDB entry) Uniprot Q74EH6 23-133 |
Domain d2ia7a1: 2ia7 A:23-133 [147585] complexed with edo, no3 |
PDB Entry: 2ia7 (more details), 1.44 Å
SCOPe Domain Sequences for d2ia7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ia7a1 d.373.1.1 (A:23-133) Uncharacterized protein GSU0986 {Geobacter sulfurreducens [TaxId: 35554]} amvlssaeediaesiriilgtargervmrpdfgcgihdrvfsvintttlglienevkeal ilwepriellsvtaspreaaegrllidieyrvrstntrfnlvypfylkesa
Timeline for d2ia7a1: