Lineage for d2ia1b2 (2ia1 B:2-166)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011545Fold d.359: BH3703-like [160423] (1 superfamily)
    alpha-beta(3)-alpha-beta(2)-alpha(2); antiparallel beta-sheet, order:32145; duplication: two alpha-beta(2) structural repeats are arranged with pseudo twofold symmetry
  4. 3011546Superfamily d.359.1: BH3703-like [160424] (1 family) (S)
    automatically mapped to Pfam PF04634
  5. 3011547Family d.359.1.1: BH3703-like [160425] (1 protein)
    Pfam PF04634; DUF600
  6. 3011548Protein Uncharacterized protein BH3703 [160426] (1 species)
  7. 3011549Species Bacillus halodurans [TaxId:86665] [160427] (2 PDB entries)
    Uniprot Q9K6M5 1-166
  8. 3011551Domain d2ia1b2: 2ia1 B:2-166 [147584]
    Other proteins in same PDB: d2ia1a2, d2ia1a3, d2ia1b3, d2ia1b4
    automated match to d2ia1a1
    complexed with gol, so4

Details for d2ia1b2

PDB Entry: 2ia1 (more details), 1.59 Å

PDB Description: crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
PDB Compounds: (B:) BH3703 protein

SCOPe Domain Sequences for d2ia1b2:

Sequence, based on SEQRES records: (download)

>d2ia1b2 d.359.1.1 (B:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]}
ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird
vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd
tfltrlawqyehfgtipedsfyketlneyleekaqgkrypflepl

Sequence, based on observed residues (ATOM records): (download)

>d2ia1b2 d.359.1.1 (B:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]}
ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird
vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd
tfltrlawqyehfgtipdsfyketlneyleekaqgkrypflepl

SCOPe Domain Coordinates for d2ia1b2:

Click to download the PDB-style file with coordinates for d2ia1b2.
(The format of our PDB-style files is described here.)

Timeline for d2ia1b2: