![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.359: BH3703-like [160423] (1 superfamily) alpha-beta(3)-alpha-beta(2)-alpha(2); antiparallel beta-sheet, order:32145; duplication: two alpha-beta(2) structural repeats are arranged with pseudo twofold symmetry |
![]() | Superfamily d.359.1: BH3703-like [160424] (1 family) ![]() automatically mapped to Pfam PF04634 |
![]() | Family d.359.1.1: BH3703-like [160425] (1 protein) Pfam PF04634; DUF600 |
![]() | Protein Uncharacterized protein BH3703 [160426] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [160427] (2 PDB entries) Uniprot Q9K6M5 1-166 |
![]() | Domain d2ia1b2: 2ia1 B:2-166 [147584] Other proteins in same PDB: d2ia1a2, d2ia1a3, d2ia1b3, d2ia1b4 automated match to d2ia1a1 complexed with gol, so4 |
PDB Entry: 2ia1 (more details), 1.59 Å
SCOPe Domain Sequences for d2ia1b2:
Sequence, based on SEQRES records: (download)
>d2ia1b2 d.359.1.1 (B:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]} ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd tfltrlawqyehfgtipedsfyketlneyleekaqgkrypflepl
>d2ia1b2 d.359.1.1 (B:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]} ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd tfltrlawqyehfgtipdsfyketlneyleekaqgkrypflepl
Timeline for d2ia1b2: