SCOPe 2.08: Domain d2ia1a1: 2ia1 A:2-166

Lineage for d2ia1a1 (2ia1 A:2-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.359: BH3703-like [160423] (1 superfamily)
   alpha-beta(3)-alpha-beta(2)-alpha(2); antiparallel beta-sheet, order:32145; duplication: two alpha-beta(2) structural repeats are arranged with pseudo twofold symmetry

4. Superfamily d.359.1: BH3703-like [160424] (1 family)
   automatically mapped to Pfam PF04634

5. Family d.359.1.1: BH3703-like [160425] (1 protein)
   Pfam PF04634; DUF600

6. Protein Uncharacterized protein BH3703 [160426] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [160427] (2 PDB entries)
   Uniprot Q9K6M5 1-166

8. Domain d2ia1a1: 2ia1 A:2-166 [147583]
   Other proteins in same PDB: d2ia1a2, d2ia1a3, d2ia1b3, d2ia1b4
   complexed with gol, so4

Details for d2ia1a1

PDB Entry: 2ia1, 1.59 Å

PDB Description: crystal structure of protein bh3703 from bacillus halodurans, pfam duf600

PDB Compounds: (A:) BH3703 protein

SCOPe Domain Sequences for d2ia1a1:

Sequence, based on SEQRES records:

>d2ia1a1 d.359.1.1 (A:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]}
ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird
vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd
tfltrlawqyehfgtipedsfyketlneyleekaqgkrypflepl

Sequence, based on observed residues (ATOM records):

>d2ia1a1 d.359.1.1 (A:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]}
ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird
vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd
tfltrlawqyehfgtipdsfyketlneyleekaqgkrypflepl

Timeline for d2ia1a1:

• d2ia1a1 first appeared in SCOP 1.75
  
• d2ia1a1 appears in SCOPe 2.07