Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.366: SpoVG-like [160536] (1 superfamily) beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin |
Superfamily d.366.1: SpoVG-like [160537] (1 family) probable biological unit is a hexamer (trimer of dimers) automatically mapped to Pfam PF04026 |
Family d.366.1.1: SpoVG-like [160538] (1 protein) Pfam PF04026 |
Protein Putative septation protein SpoVG [160539] (2 species) |
Species Staphylococcus epidermidis [TaxId:1282] [160541] (2 PDB entries) Uniprot Q8CML1 1-84! Uniprot Q8CML1 1-87 |
Domain d2i9zb_: 2i9z B: [147582] automated match to d2i9za1 complexed with edo |
PDB Entry: 2i9z (more details), 2.3 Å
SCOPe Domain Sequences for d2i9zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9zb_ d.366.1.1 (B:) Putative septation protein SpoVG {Staphylococcus epidermidis [TaxId: 1282]} mkvtdvrlrkiqtdgrmkalvsitldeafvihdlrviegnsglfvampskrtpdgefrdi ahpinsdmrqeiqdavmkvydetd
Timeline for d2i9zb_: