SCOPe 2.08: Domain d2i9zb_: 2i9z B:

Lineage for d2i9zb_ (2i9z B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.366: SpoVG-like [160536] (1 superfamily)
   beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin

4. Superfamily d.366.1: SpoVG-like [160537] (1 family)
   probable biological unit is a hexamer (trimer of dimers)
   automatically mapped to Pfam PF04026

5. Family d.366.1.1: SpoVG-like [160538] (1 protein)
   Pfam PF04026

6. Protein Putative septation protein SpoVG [160539] (2 species)

7. Species Staphylococcus epidermidis [TaxId:1282] [160541] (2 PDB entries)
   Uniprot Q8CML1 1-84! Uniprot Q8CML1 1-87

8. Domain d2i9zb_: 2i9z B: [147582]
   automated match to d2i9za1
   complexed with edo

Details for d2i9zb_

PDB Entry: 2i9z, 2.3 Å

PDB Description: Structural Genomics, the Crystal structure of full-length SpoVG from Staphylococcus epidermidis ATCC 12228

PDB Compounds: (B:) Putative septation protein spoVG

SCOPe Domain Sequences for d2i9zb_:

Sequence; same for both SEQRES and ATOM records:

>d2i9zb_ d.366.1.1 (B:) Putative septation protein SpoVG {Staphylococcus epidermidis [TaxId: 1282]}
mkvtdvrlrkiqtdgrmkalvsitldeafvihdlrviegnsglfvampskrtpdgefrdi
ahpinsdmrqeiqdavmkvydetd

Timeline for d2i9zb_:

• d2i9zb_ first appeared in SCOP 1.75, called d2i9zb1
  
• d2i9zb_ appears in SCOPe 2.07