![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.366: SpoVG-like [160536] (1 superfamily) beta(5)-alpha; comprises a coiled antiparallel beta-sheet (order: 12345) packed against the C-terminal helix; the extensions of strands 4 and 5 form an isolated beta-hairpin |
![]() | Superfamily d.366.1: SpoVG-like [160537] (1 family) ![]() probable biological unit is a hexamer (trimer of dimers) automatically mapped to Pfam PF04026 |
![]() | Family d.366.1.1: SpoVG-like [160538] (1 protein) Pfam PF04026 |
![]() | Protein Putative septation protein SpoVG [160539] (2 species) |
![]() | Species Staphylococcus epidermidis [TaxId:1282] [160541] (2 PDB entries) Uniprot Q8CML1 1-84! Uniprot Q8CML1 1-87 |
![]() | Domain d2i9xa1: 2i9x A:1-84 [147579] Other proteins in same PDB: d2i9xa2, d2i9xb3 complexed with edo |
PDB Entry: 2i9x (more details), 1.8 Å
SCOPe Domain Sequences for d2i9xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9xa1 d.366.1.1 (A:1-84) Putative septation protein SpoVG {Staphylococcus epidermidis [TaxId: 1282]} mkvtdvrlrkiqtdgrmkalvsitldeafvihdlrviegnsglfvampskrtpdgefrdi ahpinsdmrqeiqdavmkvydetd
Timeline for d2i9xa1: