Lineage for d2i9wa2 (2i9w A:1-39)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038629Fold g.74: Sec-C motif [103641] (1 superfamily)
    metal(zinc)-bound fold
  4. 3038630Superfamily g.74.1: Sec-C motif [103642] (1 family) (S)
  5. 3038631Family g.74.1.1: Sec-C motif [103643] (2 proteins)
  6. 3038632Protein Hypothetical protein Psyc2064 [161249] (1 species)
  7. 3038633Species Psychrobacter arcticus [TaxId:334543] [161250] (1 PDB entry)
    Uniprot Q4FPZ7 1-39! Uniprot Q4FPZ7 159-183
  8. 3038634Domain d2i9wa2: 2i9w A:1-39 [147577]
    Other proteins in same PDB: d2i9wa1
    N-terminal SEC-C motif
    complexed with cl, zn

Details for d2i9wa2

PDB Entry: 2i9w (more details), 1.75 Å

PDB Description: crystal structure of a sec-c motif containing protein (psyc_2064) from psychrobacter arcticus at 1.75 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9wa2 g.74.1.1 (A:1-39) Hypothetical protein Psyc2064 {Psychrobacter arcticus [TaxId: 334543]}
mlfsiqtcpcqinpalnavstpllyqdccqpyhdglynq

SCOPe Domain Coordinates for d2i9wa2:

Click to download the PDB-style file with coordinates for d2i9wa2.
(The format of our PDB-style files is described here.)

Timeline for d2i9wa2: