![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins) |
![]() | Protein Guanine deaminase [159336] (3 species) |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [159339] (1 PDB entry) Uniprot Q97MB6 6-63,374-424 |
![]() | Domain d2i9ua1: 2i9u A:9-66,A:377-427 [147572] Other proteins in same PDB: d2i9ua2, d2i9ub2 complexed with fe, gol, gun |
PDB Entry: 2i9u (more details), 2.05 Å
SCOPe Domain Sequences for d2i9ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ua1 b.92.1.4 (A:9-66,A:377-427) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} nlkifkgnliftktsdkftimkdsyivvidgkiasvssnlpdkykgnpiidfrnniiiXf eegydfdalvindsnlypedydlterlerfiylgddrnimkryvcgneif
Timeline for d2i9ua1: