SCOPe 2.07: Domain d2i9ia1: 2i9i A:51-271

Lineage for d2i9ia1 (2i9i A:51-271)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.6: XCC0632-like [159594] (2 families)
   short crossover loop between strands 2 and 3; the antiparallel part of the beta-sheet (strands 3, 4 and 5) and the C-terminal helix are quite long

5. Family c.51.6.1: NLBH-like [159595] (1 protein)
   Pfam PF05211; Neuraminyllactose-binding hemagglutinin

6. Protein Hypothetical protein HP0492 [159596] (1 species)

7. Species Helicobacter pylori [TaxId:210] [159597] (1 PDB entry)
   Uniprot O25234 51-271

8. Domain d2i9ia1: 2i9i A:51-271 [147571]

Details for d2i9ia1

PDB Entry: 2i9i, 1.8 Å

PDB Description: crystal structure of helicobacter pylori protein hp0492

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i9ia1:

Sequence; same for both SEQRES and ATOM records:

>d2i9ia1 c.51.6.1 (A:51-271) Hypothetical protein HP0492 {Helicobacter pylori [TaxId: 210]}
ermktssehvtpldfnypihivqapqnhhvvgiltpriqvsdnlkpyidkfqdalinqiq
tifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiledlkmnlkdpnnpnldtlvd
qssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsgglnssnsiiheyleknke
daihkilnrmyavvmkkavteltkenidkyreaidrmkgfk

Timeline for d2i9ia1:

• d2i9ia1 first appeared in SCOP 1.75
  
• d2i9ia1 appears in SCOPe 2.06
  
• d2i9ia1 appears in the current release, SCOPe 2.08