Lineage for d2i9ia1 (2i9i A:51-271)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835189Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 835427Superfamily c.51.6: XCC0632-like [159594] (2 families) (S)
    short crossover loop between strands 2 and 3; the antiparallel part of the beta-sheet (strands 3, 4 and 5) and the C-terminal helix are quite long
  5. 835428Family c.51.6.1: NLBH-like [159595] (1 protein)
    Pfam PF05211; Neuraminyllactose-binding hemagglutinin
  6. 835429Protein Hypothetical protein HP0492 [159596] (1 species)
  7. 835430Species Helicobacter pylori [TaxId:210] [159597] (1 PDB entry)
    Uniprot O25234 51-271
  8. 835431Domain d2i9ia1: 2i9i A:51-271 [147571]

Details for d2i9ia1

PDB Entry: 2i9i (more details), 1.8 Å

PDB Description: crystal structure of helicobacter pylori protein hp0492
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2i9ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ia1 c.51.6.1 (A:51-271) Hypothetical protein HP0492 {Helicobacter pylori [TaxId: 210]}
ermktssehvtpldfnypihivqapqnhhvvgiltpriqvsdnlkpyidkfqdalinqiq
tifekrgyqvlrfqdekalnaqdkrkifsvldlkgwvgiledlkmnlkdpnnpnldtlvd
qssgsvwfnfyepesnrvvhdfavevgtfqamtytykhnnsgglnssnsiiheyleknke
daihkilnrmyavvmkkavteltkenidkyreaidrmkgfk

SCOP Domain Coordinates for d2i9ia1:

Click to download the PDB-style file with coordinates for d2i9ia1.
(The format of our PDB-style files is described here.)

Timeline for d2i9ia1: