Lineage for d2i9ca1 (2i9c A:3-123)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010174Family a.118.1.25: RPA1889-like [158764] (1 protein)
    Pfam PF09450; DUF2019; similar to the BC3264-like family
    this is a repeat family; one repeat unit is 2i9c A:56-84 found in domain
  6. 2010175Protein Hypothetical protein RPA1889 [158765] (1 species)
  7. 2010176Species Rhodopseudomonas palustris [TaxId:1076] [158766] (1 PDB entry)
    Uniprot Q6N8L4 3-123
  8. 2010177Domain d2i9ca1: 2i9c A:3-123 [147566]
    complexed with act

Details for d2i9ca1

PDB Entry: 2i9c (more details), 2 Å

PDB Description: crystal structure of the protein rpa1889 from rhodopseudomonas palustris cga009
PDB Compounds: (A:) Hypothetical protein RPA1889

SCOPe Domain Sequences for d2i9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ca1 a.118.1.25 (A:3-123) Hypothetical protein RPA1889 {Rhodopseudomonas palustris [TaxId: 1076]}
kldlhqmttqdlvalfakvtveqddallgnqisrfnrlfgvmaeiadelkardgdqrtal
lslfeypnmqvrlqaakltlavapvkareqleaivsskwfpqagdagmcldllddgtfkp
k

SCOPe Domain Coordinates for d2i9ca1:

Click to download the PDB-style file with coordinates for d2i9ca1.
(The format of our PDB-style files is described here.)

Timeline for d2i9ca1: