![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.25: RPA1889-like [158764] (1 protein) Pfam PF09450; DUF2019; similar to the BC3264-like family this is a repeat family; one repeat unit is 2i9c A:56-84 found in domain |
![]() | Protein Hypothetical protein RPA1889 [158765] (1 species) |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [158766] (1 PDB entry) Uniprot Q6N8L4 3-123 |
![]() | Domain d2i9ca1: 2i9c A:3-123 [147566] complexed with act |
PDB Entry: 2i9c (more details), 2 Å
SCOPe Domain Sequences for d2i9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ca1 a.118.1.25 (A:3-123) Hypothetical protein RPA1889 {Rhodopseudomonas palustris [TaxId: 1076]} kldlhqmttqdlvalfakvtveqddallgnqisrfnrlfgvmaeiadelkardgdqrtal lslfeypnmqvrlqaakltlavapvkareqleaivsskwfpqagdagmcldllddgtfkp k
Timeline for d2i9ca1: