SCOPe 2.01: Domain d2i8db_: 2i8d B:

Lineage for d2i8db_ (2i8d B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.4: YdhG-like [159888] (1 family)
   some similarity to YjbR-like (136320)

5. Family d.198.4.1: YdhG-like [159889] (2 proteins)
   Pfam PF08818; DUF1801

6. Protein Uncharacterized protein LSEI2283 [159890] (1 species)

7. Species Lactobacillus casei [TaxId:1582] [159891] (1 PDB entry)
   Uniprot Q035U5 2-122

8. Domain d2i8db_: 2i8d B: [147562]
   automated match to d2i8da1
   complexed with cl, gol, unl

Details for d2i8db_

PDB Entry: 2i8d, 1.69 Å

PDB Description: crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution

PDB Compounds: (B:) Uncharacterized conserved protein of COG5646

SCOPe Domain Sequences for d2i8db_:

Sequence; same for both SEQRES and ATOM records:

>d2i8db_ d.198.4.1 (B:) Uncharacterized protein LSEI2283 {Lactobacillus casei [TaxId: 1582]}
gslaewyqriptpddltrveslfanmqaqfpqlklefkwnqpmftdhgtfimgfnpskkh
lavaiepqtmtrfipqidkagydhsqiirfpwhkpldeqlihdliaytidqkkdattfwq
r

Timeline for d2i8db_:

• d2i8db_ first appeared in SCOP 1.75, called d2i8db1
  
• d2i8db_ appears in SCOPe 2.02
  
• d2i8db_ appears in the current release, SCOPe 2.08