Lineage for d2i7ta1 (2i7t A:9-459)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876759Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins)
    contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif
    contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif
  6. 876760Protein Cleavage and polyadenylation specificity factor subunit 3 [160856] (1 species)
  7. 876761Species Human (Homo sapiens) [TaxId:9606] [160857] (1 PDB entry)
    Uniprot Q9UKF6 9-459
  8. 876762Domain d2i7ta1: 2i7t A:9-459 [147559]
    complexed with so4, zn

Details for d2i7ta1

PDB Entry: 2i7t (more details), 2.1 Å

PDB Description: structure of human cpsf-73
PDB Compounds: (A:) Cleavage and polyadenylation specificity factor 73 kDa subunit

SCOP Domain Sequences for d2i7ta1:

Sequence, based on SEQRES records: (download)

>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]}
sdqllirplgagqevgrsciilefkgrkimldcgihpglegmdalpyidlidpaeidlll
ishfhldhcgalpwflqktsfkgrtfmthatkaiyrwllsdyvkvsnisaddmlytetdl
eesmdkietinfhevkevagikfwcyhaghvlgaamfmieiagvkllytgdfsrqedrhl
maaeipnikpdiliiestygthihekreerearfcntvhdivnrggrglipvfalgraqe
lllildeywqnhpelhdipiyyasslakkcmavyqtyvnamndkirkqininnpfvfkhi
snlksmdhfddigpsvvmaspgmmqsglsrelfeswctdkrngviiagycvegtlakhim
sepeeittmsgqklplkmsvdyisfsahtdyqqtsefiralkpphvilvhgeqnemarlk
aalireyedndevhievhnprnteavtlnfr

Sequence, based on observed residues (ATOM records): (download)

>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]}
sdqllirplgagqevgrsciilefkgrkimldcgihpglegmdalpyidlidpaeidlll
ishfhldhcgalpwflqktsfkgrtfmthatkaiyrwllsdyvklytetdleesmdkiet
infhevkevagikfwcyhaghvlgaamfmieiagvkllytgdfsrqmaaeipnikpdili
iestygthihekreerearfcntvhdivnrggrglipvfalgraqelllildeywqnhpe
lhdipiyyafkhisnlksmdhfddigpsvvmaspgmmqsglsrelfeswctdkrngviia
gycvegtlakhimsepeeittmsgqklplkmsvdyisfsahtdyqqtsefiralkpphvi
lvhgeqnemarlkaalireyedndevhievhnprnteavtlnfr

SCOP Domain Coordinates for d2i7ta1:

Click to download the PDB-style file with coordinates for d2i7ta1.
(The format of our PDB-style files is described here.)

Timeline for d2i7ta1: