SCOPe 2.05: Domain d2i7pb2: 2i7p B:7-152

Lineage for d2i7pb2 (2i7p B:7-152)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (4 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein Pantothenate kinase 3, PANK3 [159624] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159625] (3 PDB entries)
   Uniprot Q9H999 12-152! Uniprot Q9H999 157-368

8. Domain d2i7pb2: 2i7p B:7-152 [147554]
   automated match to d2i7pa2
   complexed with aco

Details for d2i7pb2

PDB Entry: 2i7p, 2.05 Å

PDB Description: Crystal structure of human PANK3 in complex with AcCoA

PDB Compounds: (B:) Pantothenate kinase 3

SCOPe Domain Sequences for d2i7pb2:

Sequence, based on SEQRES records:

>d2i7pb2 c.55.1.14 (B:7-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv
hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr
tignlhlhkldeldclvkgllyidsv

Sequence, based on observed residues (ATOM records):

>d2i7pb2 c.55.1.14 (B:7-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelk
dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl
hlhkldeldclvkgllyidsv

Timeline for d2i7pb2:

• d2i7pb2 first appeared in SCOP 1.75
  
• d2i7pb2 appears in SCOPe 2.04
  
• d2i7pb2 appears in SCOPe 2.06
  
• d2i7pb2 appears in the current release, SCOPe 2.08