Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (4 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Pantothenate kinase 3, PANK3 [159624] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159625] (3 PDB entries) Uniprot Q9H999 12-152! Uniprot Q9H999 157-368 |
Domain d2i7pb2: 2i7p B:7-152 [147554] automated match to d2i7pa2 complexed with aco |
PDB Entry: 2i7p (more details), 2.05 Å
SCOPe Domain Sequences for d2i7pb2:
Sequence, based on SEQRES records: (download)
>d2i7pb2 c.55.1.14 (B:7-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]} vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr tignlhlhkldeldclvkgllyidsv
>d2i7pb2 c.55.1.14 (B:7-152) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]} vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelk dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl hlhkldeldclvkgllyidsv
Timeline for d2i7pb2: