Lineage for d2i7na2 (2i7n A:382-593)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884735Family c.55.1.14: Fumble-like [159623] (6 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2884736Protein Pantothenate kinase 1, PANK1, C-terminal domain [418999] (1 species)
  7. 2884737Species Human (Homo sapiens) [TaxId:9606] [419471] (2 PDB entries)
    Uniprot Q8TE04
  8. 2884740Domain d2i7na2: 2i7n A:382-593 [147548]
    Other proteins in same PDB: d2i7na1, d2i7nb1
    complexed with aco
    has additional insertions and/or extensions that are not grouped together

Details for d2i7na2

PDB Entry: 2i7n (more details), 1.9 Å

PDB Description: Crystal structure of human PANK1 alpha: the catalytic core domain in complex with AcCoA
PDB Compounds: (A:) Pantothenate kinase 1

SCOPe Domain Sequences for d2i7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg
tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm
skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay
amdfwskgqlkalflehegyfgavgallelfk

SCOPe Domain Coordinates for d2i7na2:

Click to download the PDB-style file with coordinates for d2i7na2.
(The format of our PDB-style files is described here.)

Timeline for d2i7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i7na1