Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein Pantothenate kinase 1, PANK1, C-terminal domain [418999] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419471] (2 PDB entries) Uniprot Q8TE04 |
Domain d2i7na2: 2i7n A:382-593 [147548] Other proteins in same PDB: d2i7na1, d2i7nb1 complexed with aco has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2i7n (more details), 1.9 Å
SCOPe Domain Sequences for d2i7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay amdfwskgqlkalflehegyfgavgallelfk
Timeline for d2i7na2: