![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
![]() | Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) ![]() automatically mapped to Pfam PF00930 |
![]() | Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
![]() | Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries) Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487 |
![]() | Domain d2i78d1: 2i78 D:39-508 [147545] Other proteins in same PDB: d2i78a2, d2i78b2, d2i78c2, d2i78d2 automated match to d2bgra1 complexed with kiq |
PDB Entry: 2i78 (more details), 2.5 Å
SCOPe Domain Sequences for d2i78d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i78d1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq
Timeline for d2i78d1: