Lineage for d2i78c1 (2i78 C:39-508)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960620Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 960709Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 960710Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 960717Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 960718Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 960765Domain d2i78c1: 2i78 C:39-508 [147543]
    Other proteins in same PDB: d2i78a2, d2i78b2, d2i78c2, d2i78d2
    automatically matched to d1orva1
    complexed with kiq

Details for d2i78c1

PDB Entry: 2i78 (more details), 2.5 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dpp iv) complexed with abt-341, a cyclohexene-constrained phenethylamine inhibitor
PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2i78c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i78c1 b.70.3.1 (C:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2i78c1:

Click to download the PDB-style file with coordinates for d2i78c1.
(The format of our PDB-style files is described here.)

Timeline for d2i78c1: