SCOPe 2.01: Domain d2i78b2: 2i78 B:509-764

Lineage for d2i78b2 (2i78 B:509-764)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2i78b2: 2i78 B:509-764 [147542]
   Other proteins in same PDB: d2i78a1, d2i78b1, d2i78c1, d2i78d1
   automatically matched to d1orva2
   complexed with kiq

Details for d2i78b2

PDB Entry: 2i78, 2.5 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dpp iv) complexed with abt-341, a cyclohexene-constrained phenethylamine inhibitor

PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2i78b2:

Sequence; same for both SEQRES and ATOM records:

>d2i78b2 c.69.1.24 (B:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d2i78b2:

• d2i78b2 first appeared in SCOP 1.75
  
• d2i78b2 appears in SCOPe 2.02
  
• d2i78b2 appears in the current release, SCOPe 2.08