SCOPe 2.03: Domain d2i76b2: 2i76 B:2-154

Lineage for d2i76b2 (2i76 B:2-154)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Hypothetical protein TM1727 [159426] (1 species)
   ProC structural homologue

7. Species Thermotoga maritima [TaxId:2336] [159427] (1 PDB entry)
   Uniprot Q9X250 2-154

8. Domain d2i76b2: 2i76 B:2-154 [147538]
   Other proteins in same PDB: d2i76a1, d2i76b1
   automatically matched to 2I76 A:2-154
   complexed with ndp

Details for d2i76b2

PDB Entry: 2i76, 3 Å

PDB Description: crystal structure of protein tm1727 from thermotoga maritima

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2i76b2:

Sequence, based on SEQRES records:

>d2i76b2 c.2.1.6 (B:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}
vlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelngvvf
vivpdryiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalemkdq
ivfglegderglpivkkiaeeisgkyfvipsek

Sequence, based on observed residues (ATOM records):

>d2i76b2 c.2.1.6 (B:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}
vlnfvgtgtltrffleclkigyilsrsidrarnlaevyggkaatlekhpevvfvivpdry
iktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsflekalemkdqivfglegde
rglpivkkiaeeisgkyfviek

Timeline for d2i76b2:

• d2i76b2 first appeared in SCOP 1.75
  
• d2i76b2 appears in SCOPe 2.02
  
• d2i76b2 appears in SCOPe 2.04
  
• d2i76b2 appears in the current release, SCOPe 2.08