SCOPe 2.05: Domain d2i76b1: 2i76 B:155-254

Lineage for d2i76b1 (2i76 B:155-254)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255232] (1 PDB entry)

8. Domain d2i76b1: 2i76 B:155-254 [147537]
   Other proteins in same PDB: d2i76a1, d2i76a2, d2i76b2
   automated match to d2i76a1
   complexed with ndp

Details for d2i76b1

PDB Entry: 2i76, 3 Å

PDB Description: crystal structure of protein tm1727 from thermotoga maritima

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2i76b1:

Sequence; same for both SEQRES and ATOM records:

>d2i76b1 a.100.1.0 (B:155-254) automated matches {Thermotoga maritima [TaxId: 2336]}
kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg
pvkrgdwqvveeerreyekifgntvlydeivkllrevaes

Timeline for d2i76b1:

• d2i76b1 first appeared in SCOP 1.75
  
• d2i76b1 appears in SCOPe 2.04
  
• d2i76b1 appears in SCOPe 2.06
  
• d2i76b1 appears in the current release, SCOPe 2.08