Lineage for d2i76a2 (2i76 A:2-154)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579455Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1579552Protein Hypothetical protein TM1727 [159426] (1 species)
    ProC structural homologue
  7. 1579553Species Thermotoga maritima [TaxId:2336] [159427] (1 PDB entry)
    Uniprot Q9X250 2-154
  8. 1579554Domain d2i76a2: 2i76 A:2-154 [147536]
    Other proteins in same PDB: d2i76a1, d2i76b1, d2i76b2
    complexed with ndp

Details for d2i76a2

PDB Entry: 2i76 (more details), 3 Å

PDB Description: crystal structure of protein tm1727 from thermotoga maritima
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2i76a2:

Sequence, based on SEQRES records: (download)

>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}
vlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelngvvf
vivpdryiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalemkdq
ivfglegderglpivkkiaeeisgkyfvipsek

Sequence, based on observed residues (ATOM records): (download)

>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}
vlnfvgtgtltrffleclkigyilsrsidrarnlaevyggkaatlekhpevvfvivpdry
iktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsflekalemkdqivfglegde
rglpivkkiaeeisgkyfvipsek

SCOPe Domain Coordinates for d2i76a2:

Click to download the PDB-style file with coordinates for d2i76a2.
(The format of our PDB-style files is described here.)

Timeline for d2i76a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i76a1