Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Hypothetical protein TM1727 [159426] (1 species) ProC structural homologue |
Species Thermotoga maritima [TaxId:2336] [159427] (1 PDB entry) Uniprot Q9X250 2-154 |
Domain d2i76a2: 2i76 A:2-154 [147536] Other proteins in same PDB: d2i76a1, d2i76b1 complexed with ndp |
PDB Entry: 2i76 (more details), 3 Å
SCOP Domain Sequences for d2i76a2:
Sequence, based on SEQRES records: (download)
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} vlnfvgtgtltrffleclkdryeigyilsrsidrarnlaevyggkaatlekhpelngvvf vivpdryiktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsfsslekalemkdq ivfglegderglpivkkiaeeisgkyfvipsek
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} vlnfvgtgtltrffleclkigyilsrsidrarnlaevyggkaatlekhpevvfvivpdry iktvanhlnlgdavlvhcsgflsseifkksgrasihpnfsflekalemkdqivfglegde rglpivkkiaeeisgkyfvipsek
Timeline for d2i76a2: