![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
![]() | Protein Hypothetical protein TM1727 [158734] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [158735] (1 PDB entry) Uniprot Q9X250 155-257 |
![]() | Domain d2i76a1: 2i76 A:155-257 [147535] Other proteins in same PDB: d2i76a2, d2i76b1, d2i76b2 complexed with ndp |
PDB Entry: 2i76 (more details), 3 Å
SCOPe Domain Sequences for d2i76a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i76a1 a.100.1.10 (A:155-257) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg pvkrgdwqvveeerreyekifgntvlydeivkllrevaeserr
Timeline for d2i76a1: