SCOPe 2.08: Domain d2i6ha1: 2i6h A:1-179

Lineage for d2i6ha1 (2i6h A:1-179)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.5: Atu0120-like [158772] (1 protein)
   Pfam PF06041; DUF924

6. Protein Hypothetical protein Atu0120 [158773] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [158774] (1 PDB entry)
   Uniprot Q8UJ18 1-179

8. Domain d2i6ha1: 2i6h A:1-179 [147528]
   complexed with ca, cl

Details for d2i6ha1

PDB Entry: 2i6h, 1.75 Å

PDB Description: Structure of Protein of Unknown Function ATU0120 from Agrobacterium tumefaciens

PDB Compounds: (A:) Hypothetical protein Atu0120

SCOPe Domain Sequences for d2i6ha1:

Sequence; same for both SEQRES and ATOM records:

>d2i6ha1 a.118.8.5 (A:1-179) Hypothetical protein Atu0120 {Agrobacterium tumefaciens [TaxId: 358]}
mkndtaalaadivdfwkkagpdkwfdkdaafdnhfhdrfrdahfaaarreldgwlegaes
slalmllldqfprncfrgtahmyatdplarffadeairrghdqavsedlrvffylpfsha
ediaaqqracdlnqplgglylhhaeehrdiverfgrfphrngillrettpeerqyleeg

Timeline for d2i6ha1:

• d2i6ha1 first appeared in SCOP 1.75
  
• d2i6ha1 appears in SCOPe 2.07