Lineage for d2i6ha1 (2i6h A:1-179)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333990Family a.118.8.5: Atu0120-like [158772] (1 protein)
    Pfam PF06041; DUF924
  6. 2333991Protein Hypothetical protein Atu0120 [158773] (1 species)
  7. 2333992Species Agrobacterium tumefaciens [TaxId:358] [158774] (1 PDB entry)
    Uniprot Q8UJ18 1-179
  8. 2333993Domain d2i6ha1: 2i6h A:1-179 [147528]
    complexed with ca, cl

Details for d2i6ha1

PDB Entry: 2i6h (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function ATU0120 from Agrobacterium tumefaciens
PDB Compounds: (A:) Hypothetical protein Atu0120

SCOPe Domain Sequences for d2i6ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i6ha1 a.118.8.5 (A:1-179) Hypothetical protein Atu0120 {Agrobacterium tumefaciens [TaxId: 358]}
mkndtaalaadivdfwkkagpdkwfdkdaafdnhfhdrfrdahfaaarreldgwlegaes
slalmllldqfprncfrgtahmyatdplarffadeairrghdqavsedlrvffylpfsha
ediaaqqracdlnqplgglylhhaeehrdiverfgrfphrngillrettpeerqyleeg

SCOPe Domain Coordinates for d2i6ha1:

Click to download the PDB-style file with coordinates for d2i6ha1.
(The format of our PDB-style files is described here.)

Timeline for d2i6ha1: