![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Hypothetical protein DR0370 [159814] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159815] (1 PDB entry) Uniprot Q9RXE3 14-285 |
![]() | Domain d2i6ef_: 2i6e F: [147525] automated match to d2i6ea1 complexed with so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2i6e (more details), 2.5 Å
SCOPe Domain Sequences for d2i6ef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i6ef_ c.94.1.1 (F:) Hypothetical protein DR0370 {Deinococcus radiodurans [TaxId: 1299]} pyragwihftnvapildslelppgvtaitgvptqmnaallsgevdianvsavefirhadt laalpdfsvavlgpvysvnlfhtcplpelrrvaltsqsamsvallevllrqkglspvler aegtaesllaagydgvlrigddalrewygvvgpltpertmtslphtgrgitvtdlaqewf dltghpftfavwayrkdnpppaallqamrearrrgighlaevsqrhaeklglpervvqhy lwnfryhleapdrlglrefadlavpghaeltf
Timeline for d2i6ef_: