Lineage for d2i5rc_ (2i5r C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923405Fold c.136: Toprim domain [110454] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2923406Superfamily c.136.1: Toprim domain [110455] (1 family) (S)
    this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)
  5. 2923407Family c.136.1.1: Toprim domain [110456] (3 proteins)
    Pfam PF01751
  6. 2923417Protein automated matches [190389] (1 species)
    not a true protein
  7. 2923418Species Geobacillus stearothermophilus [TaxId:1422] [187250] (1 PDB entry)
  8. 2923421Domain d2i5rc_: 2i5r C: [147518]
    automated match to d2fcja1
    complexed with gol, mes, mg, so4

Details for d2i5rc_

PDB Entry: 2i5r (more details), 1.65 Å

PDB Description: structure of small toprim domain-containing protein from b. stearothermophilus in complex with mg2+
PDB Compounds: (C:) Toprim domain-containing protein

SCOPe Domain Sequences for d2i5rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5rc_ c.136.1.1 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgr

SCOPe Domain Coordinates for d2i5rc_:

Click to download the PDB-style file with coordinates for d2i5rc_.
(The format of our PDB-style files is described here.)

Timeline for d2i5rc_: