SCOP 1.75: Domain d2i5rb1: 2i5r B:2-114

Lineage for d2i5rb1 (2i5r B:2-114)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (2 proteins)
   Pfam PF01751

6. Protein Hypothetical protein RBSTP2199 [142016] (1 species)
   B. subtilis YusF homolog

7. Species Bacillus stearothermophilus [TaxId:1422] [142017] (2 PDB entries)
   Uniprot Q5KVJ9 1-114

8. Domain d2i5rb1: 2i5r B:2-114 [147517]
   automatically matched to d2fcja1
   complexed with gol, mes, mg, so4

Details for d2i5rb1

PDB Entry: 2i5r, 1.65 Å

PDB Description: structure of small toprim domain-containing protein from b. stearothermophilus in complex with mg2+

PDB Compounds: (B:) Toprim domain-containing protein

SCOP Domain Sequences for d2i5rb1:

Sequence; same for both SEQRES and ATOM records:

>d2i5rb1 c.136.1.1 (B:2-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]}
rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade
ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm

Timeline for d2i5rb1:

• d2i5rb1 is new in SCOP 1.75
  
• d2i5rb1 is called d2i5rb_ in SCOPe 2.01
  
• d2i5rb1 appears in the current release, SCOPe 2.08, called d2i5rb_