SCOPe 2.07: Domain d2i5ra_: 2i5r A:

Lineage for d2i5ra_ (2i5r A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (3 proteins)
   Pfam PF01751

6. Protein automated matches [190389] (1 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [187250] (1 PDB entry)

8. Domain d2i5ra_: 2i5r A: [147516]
   automated match to d2fcja1
   complexed with gol, mes, mg, so4

Details for d2i5ra_

PDB Entry: 2i5r, 1.65 Å

PDB Description: structure of small toprim domain-containing protein from b. stearothermophilus in complex with mg2+

PDB Compounds: (A:) Toprim domain-containing protein

SCOPe Domain Sequences for d2i5ra_:

Sequence; same for both SEQRES and ATOM records:

>d2i5ra_ c.136.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
amrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvyllada
deageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm

Timeline for d2i5ra_:

• d2i5ra_ first appeared in SCOP 1.75, called d2i5ra1
  
• d2i5ra_ appears in SCOPe 2.06
  
• d2i5ra_ appears in the current release, SCOPe 2.08