Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.136: Toprim domain [110454] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.136.1: Toprim domain [110455] (1 family) this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731) |
Family c.136.1.1: Toprim domain [110456] (2 proteins) Pfam PF01751 |
Protein Hypothetical protein RBSTP2199 [142016] (1 species) B. subtilis YusF homolog |
Species Bacillus stearothermophilus [TaxId:1422] [142017] (2 PDB entries) Uniprot Q5KVJ9 1-114 |
Domain d2i5ra1: 2i5r A:1-114 [147516] automatically matched to d2fcja1 complexed with gol, mes, mg, so4 |
PDB Entry: 2i5r (more details), 1.65 Å
SCOP Domain Sequences for d2i5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i5ra1 c.136.1.1 (A:1-114) Hypothetical protein RBSTP2199 {Bacillus stearothermophilus [TaxId: 1422]} mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm
Timeline for d2i5ra1: