Lineage for d2i5ib_ (2i5i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850726Family c.6.2.8: YdjC-like [159441] (1 protein)
    Pfam PF04794
  6. 2850727Protein Uncharacterized protein EF3048 [159442] (1 species)
  7. 2850728Species Enterococcus faecalis [TaxId:1351] [159443] (1 PDB entry)
    Uniprot P59745 2-262
  8. 2850730Domain d2i5ib_: 2i5i B: [147515]
    automated match to d2i5ia1

Details for d2i5ib_

PDB Entry: 2i5i (more details), 1.7 Å

PDB Description: crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution
PDB Compounds: (B:) UPF0249 protein EF_3048

SCOPe Domain Sequences for d2i5ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5ib_ c.6.2.8 (B:) Uncharacterized protein EF3048 {Enterococcus faecalis [TaxId: 1351]}
snkkliinaddfgytpavtqgiieahkrgvvtsttalptspyfleamesarisaptlaig
vhltltlnqakpilpremvpslvdeagyfwhqsifeekvnleevynewdaqiisfmksgr
rpdhidshhnvhgknkkllgvalalarkyqlplrnasrsietkdylelyqdvrtpdemly
qfydkaistetilqlldmvvcsegevfeinchpafidtilqnqsgycmprireveiltsq
evkeaieergillanyeslam

SCOPe Domain Coordinates for d2i5ib_:

Click to download the PDB-style file with coordinates for d2i5ib_.
(The format of our PDB-style files is described here.)

Timeline for d2i5ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i5ia1