SCOP 1.75: Domain d2i5fa1: 2i5f A:244-347

Lineage for d2i5fa1 (2i5f A:244-347)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d2i5fa1: 2i5f A:244-347 [147512]
   automatically matched to d1xx0a1
   complexed with 5ip

Details for d2i5fa1

PDB Entry: 2i5f, 1.35 Å

PDB Description: Crystal structure of the C-terminal PH domain of pleckstrin in complex with D-myo-Ins(1,2,3,5,6)P5

PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d2i5fa1:

Sequence, based on SEQRES records:

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvesn
sngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records):

>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
viikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvese
enlfeiitadevhyflqaatpkertewikaiqmasr

Timeline for d2i5fa1:

• d2i5fa1 is new in SCOP 1.75
  
• d2i5fa1 is called d2i5fa_ in SCOPe 2.01
  
• d2i5fa1 appears in the current release, SCOPe 2.08, called d2i5fa2